PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007974P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 152aa    MW: 17587.1 Da    PI: 10.4286
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007974P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.42.2e-262877352
          RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                    + i+l+dl+k+F  pi++A+++L+v+lTvLKr+CR++GI+RWPhRkiks+
  MELO3C007974P1 28 AGITLSDLAKNFGVPITEASRNLNVGLTVLKRKCREFGIHRWPHRKIKSI 77
                    679*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.8711397IPR003035RWP-RK domain
PfamPF020421.1E-213077IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MEESCDESGG ELIGIAEKKR RATSEHIAGI TLSDLAKNFG VPITEASRNL NVGLTVLKRK  60
CREFGIHRWP HRKIKSIDGL IRDLQEEAKH REEDHKALMA VTKRQMMLQN ERERIERTPF  120
RELESETKRF RQDVFRRKHK ARALESQSPS V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-127LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-127LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440913.11e-106PREDICTED: protein RKD5 isoform X1
RefseqXP_008440912.11e-106PREDICTED: protein RKD5 isoform X1
SwissprotO817911e-42RKD5_ARATH; Protein RKD5
TrEMBLA0A0A0KGY85e-95A0A0A0KGY8_CUCSA; Uncharacterized protein
STRINGGLYMA11G09080.13e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.16e-44RWP-RK domain-containing protein